en · de · pt
liraglutide-notes.peptides6823.com › Guide › Identity And Biochemical Role — Background and Details

Identity And Biochemical Role — Background and Details

By Editorial Desk · published 2026-01-31 · last reviewed 2026-03-21 · Guide

If you have been reading about LC-MS and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.

Last reviewed on 2026-03-21. Where a claim depends on a specific study, the study is described rather than over-claimed.

Identity And Biochemical Role

Biosynthesis occurs through salvage, Preiss-Handler, and de novo pathways. In mammals, the salvage pathway from nicotinamide predominates, and NAMPT is often described as rate-limiting. Nicotinamide riboside and nicotinic acid enter related routes that converge on NAD+ production. Tissue NAD+ concentrations vary widely and are maintained by a balance of synthesis and consumption. Some studies report age-related declines in certain tissues, but whether these changes cause disease or can be reversed to improve human health remains an open question.

NAD+ stands for nicotinamide adenine dinucleotide, the oxidized form of a coenzyme found in all living cells. The molecule consists of two nucleotides, adenine and nicotinamide ribose, joined through phosphate groups. Its chemical formula is C21H27N7O14P2, and the free acid has a molar mass near 663.43 grams per mole. In redox reactions, NAD+ accepts a hydride ion and becomes NADH. The pair NAD+ and NADH participates in hundreds of metabolic reactions, including steps in glycolysis, the citric acid cycle, and oxidative phosphorylation.

In cells, NAD+ functions primarily as an electron carrier. Dehydrogenase enzymes in glycolysis and the citric acid cycle transfer hydride from substrates to NAD+, producing NADH. NADH then delivers electrons to the mitochondrial respiratory chain, supporting ATP synthesis. In fermentation, NADH is reoxidized to NAD+ so that glycolysis can continue. The balance between NAD+ and NADH helps set metabolic flux. Beyond redox, NAD+ serves as a substrate for enzymes that cleave it, including sirtuins, poly(ADP-ribose) polymerases, and CD38. These reactions consume NAD+ and release nicotinamide and ADP-ribose products.

Measurement Stability and Handling

Solid NAD+ is relatively stable when kept dry, cold, and protected from light. Aqueous solutions are more vulnerable to hydrolysis and can lose activity during repeated freeze-thaw cycles or prolonged storage at ambient temperature. Stability depends on pH, ionic strength, and the presence of degrading enzymes or metal ions. For many laboratory uses, aliquots are stored frozen and thawed only once. Exact degradation rates vary by matrix, so stability should be checked for each application rather than assumed.

Laboratory handling of NAD+ follows standard practices for hygroscopic fine chemicals. Personnel typically avoid inhalation and skin contact, use gloves and eye protection, and work in a ventilated area. Quality control may include ultraviolet absorbance at the nicotinamide maximum, chromatographic purity, water content, and identity confirmation by mass spectrometry. Because commercial preparations can contain counterions, residual solvents, or related nucleotides, a certificate of analysis helps verify the material. Researchers should confirm that the form supplied matches the intended assay.

Measuring NAD+ in biological samples requires care because the molecule is chemically reactive and present at low concentrations in some tissues. Common approaches include enzymatic cycling assays, high-performance liquid chromatography, and liquid chromatography coupled to mass spectrometry. Each method has different sensitivity and specificity, and sample preparation can affect results. Acidic or alkaline extraction steps are used in some protocols, but the choice depends on the analyte and matrix. No single method is universally optimal for every tissue or fluid.

Nad-plus at a glance

PropertyValueNotes
Molecular formulaC21H27N7O14P2Oxidized form; NADH adds a hydride equivalent.
Molar mass663.43 g/molFree acid form; salts have different values.
CAS Registry Number53-84-9Common identifier for beta-NAD.
AppearanceWhite to off-white powderHygroscopic; may absorb moisture from air.
SolubilityFreely soluble in waterPoorly soluble in most organic solvents.

Laboratory Handling and Measurement

Commercial NAD+ is available at research grade, often with purity specifications determined by high-performance liquid chromatography. Certificates of analysis may report water content, residual solvents, and counterion identity. Identity can be confirmed by ultraviolet absorbance near 260 nm, mass spectrometry, or enzymatic activity. Because different salt forms and hydration states exist, researchers should verify that the product matches the intended molecular form. Lot-to-lot variation in purity can affect quantitative assays and should be documented.

Solid NAD+ is usually supplied as a white to off-white powder or lyophilized preparation. It is hygroscopic and should be kept desiccated at low temperature, commonly -20 °C or below for long-term storage. Aqueous solutions are less stable than dry material and are often prepared fresh or stored frozen in aliquots. Light exposure and repeated freeze-thaw cycles can promote degradation, so amber containers and single-use aliquots are preferred. Buffered solutions near neutral pH are generally less stable than acidic or frozen preparations.

Related pages on this site

Analytical Measurement and Storage Practices

Stability studies show that NAD+ can hydrolyze under prolonged heat, extreme pH, or microbial contamination. Phosphate buffers near neutral pH are often used for short-term handling, though exact stability depends on concentration, temperature, and matrix. In biological samples, endogenous enzymes can rapidly degrade NAD+, making cold chain and fast processing important. Analytical reports should state extraction conditions, internal standards, and validation parameters. Without those details, comparisons across studies remain difficult and potentially misleading.

Laboratory measurement of NAD+ often begins with rapid quenching of cell or tissue samples to prevent enzymatic conversion. Acidic or alkaline extraction can precipitate proteins, but the chosen method affects recovery of oxidized and reduced forms. Enzymatic cycling assays provide high sensitivity by amplifying a NAD+-dependent reaction. High-performance liquid chromatography and mass spectrometry offer separation and structural confirmation. Each method has trade-offs in throughput, specificity, and the ability to distinguish NAD+ from close analogues.

Background and Biochemical Roles

Beyond redox chemistry, NAD+ acts as a substrate for several enzyme families. ADP-ribosyltransferases, sirtuins, and CD38 ectoenzymes cleave the molecule into nicotinamide and ADP-ribose or related products. These reactions connect NAD+ availability to processes such as DNA repair, chromatin modification, and calcium signaling. Because the coenzyme is used in both electron transfer and signaling, cells maintain separate pools in compartments including the cytosol, mitochondria, and nucleus. The relative sizes and regulation of those pools remain active areas of study.

Cells produce NAD+ through several biosynthetic routes. The salvage pathway recycles nicotinamide, while the Preiss-Handler pathway uses nicotinic acid, and a de novo route can start from tryptophan in some organisms. In mammals, the salvage pathway is generally considered the main source under ordinary conditions. Tissue concentrations vary widely by cell type and compartment, and measured declines with age have been reported in some studies. Whether such changes drive aging or mainly accompany it remains an open question.

Nicotinamide adenine dinucleotide, commonly abbreviated NAD+, is a coenzyme present in all living cells. The molecule consists of two nucleotides linked by phosphate groups, with adenine and a nicotinamide ring as its principal features. In its oxidized form, the nicotinamide ring can accept a hydride ion, becoming NADH. This reversible conversion places NAD+ at the center of many electron-transfer reactions. Its role as a redox carrier is well established across bacteria, plants, fungi, and animals.

Biochemical Roles of NAD+

NAD+ is a dinucleotide composed of adenine, ribose, and nicotinamide moieties linked by phosphate groups. Its oxidized form carries a positive charge on the nicotinamide ring, which enables reversible hydride transfer. The molecule functions as a coenzyme in oxidoreductase reactions rather than as a dietary vitamin in its intact form. Cells maintain separate pools in cytoplasm, mitochondria, and nucleus. This compartmentalization allows distinct redox environments while preserving a shared chemical identity.

In glycolysis, NAD+ accepts electrons during the oxidation of glyceraldehyde-3-phosphate, forming NADH. The tricarboxylic acid cycle and fatty acid oxidation also generate NADH, which donates electrons to the mitochondrial electron transport chain. This flow supports ATP synthesis and helps maintain the redox balance of the cell. Other dehydrogenases use NAD+ as a cofactor for biosynthetic reductions and detoxification reactions. NADH is later reoxidized to sustain continued flux through these pathways.

Further detail

Pyocyanin (PCN−) is one of the many toxic compounds produced and secreted by the Gram negative bacterium Pseudomonas aeruginosa. Pyocyanin is a blue secondary metabolite, turning red below pH 4.9, with the ability to oxidise and reduce other molecules and therefore kill microbes competing against P. aeruginosa as well as mammalian cells of the lungs which P. aeruginosa has infected during cystic fibrosis. Since pyocyanin is a zwitterion at blood pH, it is easily able to cross the cell membrane. There are three different states in which pyocyanin can exist: oxidized (blue), monovalently reduced (colourless) or divalently reduced (red). Mitochondria play an important role in the cycling of pyocyanin between its redox states. Due to its redox-active properties, pyocyanin generates reactive oxygen species.

creating non-viral transfection agents, developing preparations for biotechnological production and gene therapy; creating new programmable materials based on hybrid nanoparticles for medicine and biochemistry; developing direct synthesis methods, studying structure and properties of new sulphur derivatives of five-membered oxygen- and nitrogen-containing heterocycles; searching for chemo-, region- and stereo-selective thiating and aminating reactions with the view to create new antimicrobial agents based on studied heterocycles; developing new principles of pathogenic microflora control in collaboration with biologists. New organic synthesis methods are developed here, as well.

Lewis acids have been classified in the ECW model and it has been shown that there is no one order of acid strengths. The relative acceptor strength of Lewis acids toward a series of bases, versus other Lewis acids, can be illustrated by C-B plots. It has been shown that to define the order of Lewis acid strength at least two properties must be considered. For Pearson's qualitative HSAB theory the two properties are hardness and strength while for Drago's quantitative ECW model the two properties are electrostatic and covalent. Monoprotic acids, also known as monobasic acids, are those acids that are able to donate one proton per molecule during the process of dissociation (sometimes called ionization) as shown below (symbolized by HA):

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Sources: en.wikipedia.org

Background from the literature

The marine sulfur cycle is driven by sulfate reduction because hydrogen sulfide is oxidized by microbes for energy or is oxidized abiotically. Dissimilatory sulfate reduction is driven by the degradation of buried organic matter and anaerobic oxidation of methane (AOM) both of which produce carbon dioxide. At depths where sulfate is depleted, methanogenesis is prevalent. At the sulfate-methane transition zone (SMTZ), the upwelling of methane produced by the methanogens is met by the anaerobic methanotrophic archaea in the SMTZ which oxidize it using sulfate as an electron acceptor. More sulfate is present at the SMTZ than methane. A 4:1 ratio of sulfate: methane is observed and the excess sulfate is directed towards organic matter degradation. Syntrophic aggregates of sulfate reducers and methanotrophs have been discovered and the underlying mechanisms observed include direct interspecies electron transfer using large multi heme complexes.

The PHLPP isoforms (PH domain and Leucine rich repeat Protein Phosphatases) are a pair of protein phosphatases, PHLPP1 and PHLPP2, that are important regulators of Akt serine-threonine kinases (Akt1, Akt2, Akt3) and conventional/novel protein kinase C (PKC) isoforms. PHLPP may act as a tumor suppressor in several types of cancer due to its ability to block growth factor-induced signaling in cancer cells. PHLPP dephosphorylates Ser-473 (the hydrophobic motif) in Akt, thus partially inactivating the kinase. In addition, PHLPP dephosphorylates conventional and novel members of the protein kinase C family at their hydrophobic motifs, corresponding to Ser-660 in PKCβII.

13. Ir Med J. 2026 Sep 28;119(8):160. Non-Arteritic Anterior Ischaemic Optic Neuropathy Associated with Semaglutide use. Kearney M, Smyth NM, Hassan HSA, Khan MS. PRESENTATION: Non-arteritic ischaemic optic neuropathy (NAION) is a common cause of acute, painless monocular visual disturbance in older adults. This case discusses a woman in her 70s with vascular risk factors who presented with a three-day history of progressive left sided visual disturbance. Examination demonstrated a left relative afferent pupillary defect and inferior quadrantopia. DIAGNOSIS: Haematological investigations and neuroimaging were unremarkable. Formal ophthalmological assessment demonstrated superior optic disc swelling with an inferior visual field defect, consistent with NAION. TREATMENT: The patient had been taking semaglutide, as prescribed, for the six months prior to presentation. This was identified as a potential contributory agent and was discontinued. Visual acuity partially improved following cessation of semaglutide. DISCUSSION: This case seeks to highlight a possible association between semaglutide use and NAION. Although causality remains unproven, it underscores the importance of pharmacovigilance when manging patients presenting with ophthalmological symptoms.

Aviation Safety Network Established in 1996. The ASN Safety Database contains descriptions of over 15800 airliner, military and corporate jet aircraft accidents/incidents since 1921. Bureau of Aircraft Accidents Archives Established in 2000. The B3A contains descriptions of over 22,000 airliner, military and corporate jet aircraft accidents since 1918. National Transportation Safety Board Aviation Accident Synopses – by month Aviation Statistics Statistical and geospatial analysis of general aviation accidents. Aviation Accidents App Access the NTSB Aviation Accidents Database and Final Reports from all over the world on your mobile device Aviation Accidents Map Explore an interactive map showcasing airplane crash sites Air Crash Map | Interactive Aviation Accident Database

In a few people, acromegaly is caused by tumors of the pancreas, lungs, and adrenal glands. These tumors also lead to an excess of GH, either because they produce GH themselves or, more frequently, because they produce GHRH (growth hormone-releasing hormone), the hormone that stimulates the pituitary to make GH. When these nonpituitary tumors are surgically removed, GH levels fall and the symptoms of acromegaly improve. Diagnosis is by measuring growth hormone after a person has consumed a glucose solution, or by measuring insulin-like growth factor I in the blood. After diagnosis, medical imaging of the pituitary is carried out to determine if an adenoma is present. If excess growth hormone is produced during childhood, the result is the condition gigantism rather than acromegaly, and it is characterized by excessive height. An MRI of the brain focusing on the sella turcica after gadolinium administration allows for clear delineation of the pituitary and the hypothalamus and the location of the tumor.

Sources: en.wikipedia.org

Further detail

Collisional excitation in mass spectrometry is the process where an ion collides with an atom or molecule and leads to an increase in the internal energy of the ion. Molecular ions are accelerated to high kinetic energy and then collide with neutral gas molecules (e.g. helium, nitrogen or argon). In the collision some of the kinetic energy is converted into internal energy which results in fragmentation in a process known as collision-induced dissociation. Collision-induced absorption and emission

Zenobi-Wong works in the area of tissue engineering, in particular for cartilage regeneration. She develops functional biomaterials which mimic the extracellular matrix. The biofabrication techniques used to develop these materials include electrospinning, casting, two-photon polymerization and bioprinting. Zenobi-Wong holds four licensed patents in the fields of tissue engineering, tissue engineering techniques, and gene expression assays. She was one of the originators of the MSc Biomedical Engineering program at ETH Zürich, and developed several graduate level courses in tissue engineering and biomedical engineering. Zenobi-Wong currently serves as President of the Swiss Society for Biomaterials and Regenerative Medicine, and as secretary general of the International Society of Biofabrication. ETH Zürich Department of Health Sciences and Technology - Tissue Engineering and Biofabrication Group Marcy Zenobi-Wong publications indexed by Google Scholar

The toxin has two subunits—designated A (mol. wt. 32000 Da) and B (mol. wt. 7700 Da)—and is one of the AB5 toxins. The B subunit is a pentamer that binds to specific glycolipids on the host cell, specifically globotriaosylceramide (Gb3). Following this, the A subunit is internalised and cleaved into two parts. The A1 component then binds to the ribosome, disrupting protein synthesis. Stx-2 has been found to be about 400 times more toxic (as quantified by LD50 in mice) than Stx-1. Gb3 is, for unknown reasons, present in greater amounts in renal epithelial tissues, to which the renal toxicity of Shiga toxin may be attributed. Gb3 is also found in central nervous system neurons and endothelium, which may lead to neurotoxicity. Stx-2 is also known to increase the expression of its receptor GB3 and cause neuronal dysfunctions. 2011 German E. coli outbreak Cholera toxin Enterotoxin Pertussis toxin

The Japan Transport Safety Board investigates aviation accidents and incidents. The Aircraft Accident Investigation Commission investigated aviation accidents and incidents in Japan until October 1, 2001, when the Aircraft and Railway Accidents Investigation Commission (ARAIC) replaced it, and the ARAIC did this function until October 1, 2008, when it merged into the JTSB. Established in 2016, the Air Accident Investigation Bureau (AAIB) Malaysia is the main investigation body for aircraft accident/incident. Separate from Civil Aviation Authority of Malaysia (CAAM) and Malaysian Aviation Commission (MAVCOM) that is the national aviation authority and commission that oversee aviation economy respectively. The AAIB operates from the ministry of transport headquarters in Putrajaya, and its black box laboratory situated in STRIDE, the ministry of defenses research institute. AAIB Malaysia is teamed by civilians and seconded Royal Malaysian Airforce senior officer and a group of pool investigators from Malaysia Institute of Aviation Technology

Apical dominance occurs when the shoot apex inhibits the growth of lateral buds so that the plant may grow vertically. It is important for the plant to devote energy to growing upward so that it can get more light to undergo photosynthesis. If the plant utilizes available energy for growing upward, it may be able to outcompete other individuals in the vicinity. Plants that were capable of outcompeting neighboring plants likely had higher fitness. Apical dominance is therefore most likely adaptive. Typically, the end of a shoot contains an apical bud, which is the location where shoot growth occurs. The apical bud produces a plant hormone, auxin (IAA), that inhibits growth of the lateral buds further down on the stem towards the axillary bud. Auxin is predominantly produced in the growing shoot apex and is transported throughout the plant via the phloem and diffuses into lateral buds which prevents elongation. That auxin likely regulates apical dominance was first discovered in 1934. When the apical bud is removed, the lowered IAA concentration allows the lateral buds to grow and produce new shoots, which compete to become the lead growth.

Sources: en.wikipedia.org

Frequently asked questions

What does NAD+ stand for?

Nicotinamide adenine dinucleotide, with the plus sign indicating the oxidized form. It is a coenzyme present in all living cells. The reduced form is NADH.

Is NAD+ the same as NADH?

No. NAD+ is oxidized and accepts electrons, while NADH is reduced and carries them. Together they form a redox pair central to energy metabolism.

Can NAD+ be obtained directly from food?

NAD+ itself is not a common dietary component in significant amounts. Precursors such as nicotinamide, nicotinic acid, and nicotinamide riboside can be converted through biosynthetic pathways. Direct absorption of intact NAD+ is limited.

Which methods quantify NAD+?

Common laboratory methods include enzymatic cycling, high-performance liquid chromatography, and liquid chromatography with mass spectrometry. The choice depends on sample type, expected concentration, and available equipment.

Network